PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g32430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GATA
Protein Properties Length: 261aa    MW: 29347.1 Da    PI: 7.1408
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g32430genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.8e-18169203135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  CA00g32430 169 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 203
                 *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.2E-822250IPR016679Transcription factor, GATA, plant
Gene3DG3DSA:3.30.50.102.3E-14162200IPR013088Zinc finger, NHR/GATA-type
SMARTSM004017.2E-16163213IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.807163199IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.04E-15164227No hitNo description
CDDcd002023.04E-14168215No hitNo description
PROSITE patternPS003440169194IPR000679Zinc finger, GATA-type
PfamPF003206.9E-16169203IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MDVYGVSAPD LFRIDDLLDF SNDQIFSTNN TNPDSSSHQY HHQPHSHNSS SAATATYYDN  60
LLPNSSDDFT DNLYVPSDDV AELEWLSNFV EDSFSNFSAN SITGTMNLSS NTTSFHGRSR  120
SKRSRSTSSW TTSLQNPNTT TTTKNKESSS VHTRERSFSP MDEDAPRRCT HCASEKTPQW  180
RTGPLGPKTL CNACGVRYKS GRLVPEYRPA ASPTFVLTQH SNSHRKVMEL RRQKEMLHQP  240
QQLPPPTTEE GMYGRHFRVC *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117122RSRSKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016545286.10.0PREDICTED: GATA transcription factor 4-like
SwissprotO497412e-75GATA2_ARATH; GATA transcription factor 2
TrEMBLM1CGF51e-141M1CGF5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000669531e-140(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.14e-63GATA transcription factor 4